PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G168400.1.p
Common NameGLYMA_06G168400, LOC100796070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family WRKY
Protein Properties Length: 161aa    MW: 18602 Da    PI: 9.5509
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G168400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.45.1e-3273131159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYG+K vk+++fprsYYrC++++C+vkk+++r ++d+++v++tYeg+H+h+
  Glyma.06G168400.1.p  73 LDDGYQWRKYGKKIVKNNKFPRSYYRCSHQDCNVKKQIQRHSRDEQIVVTTYEGTHTHP 131
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.9E-3258131IPR003657WRKY domain
SuperFamilySSF1182901.18E-2866132IPR003657WRKY domain
PROSITE profilePS5081128.31168133IPR003657WRKY domain
SMARTSM007743.1E-3673132IPR003657WRKY domain
PfamPF031063.4E-2674131IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MEKHQVMLPT SSTSSTPFSS DFKVDYINST VHVENEAIRT QRKAISAQNK RDKEFIIKQH  60
RYVFQTKSPV DVLDDGYQWR KYGKKIVKNN KFPRSYYRCS HQDCNVKKQI QRHSRDEQIV  120
VTTYEGTHTH PVDKSAESFD QILGNLLIGN LVCNVPPTLE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-2565130974Probable WRKY transcription factor 4
2lex_A3e-2565130974Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528102.11e-118PREDICTED: probable WRKY transcription factor 43 isoform X1
SwissprotQ9FYA23e-42WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A0B2RKR71e-118A0A0B2RKR7_GLYSO; Putative WRKY transcription factor 75
TrEMBLK7KVJ11e-118K7KVJ1_SOYBN; Uncharacterized protein
STRINGGLYMA06G17690.21e-118(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.14e-43WRKY DNA-binding protein 75